PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna23226.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family LBD
Protein Properties Length: 225aa    MW: 24187.6 Da    PI: 5.1871
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna23226.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260133.58.3e-42541531100
                   DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqq 86 
                              +CaaCk+lrr+C++ Cvlapyfp ++p kf ++h++FGasn++k+l++lpe++r da+ss+vyeA+ar+rdPvyG++g i +lq+q
  mrna23226.1-v1.0-hybrid  54 PCAACKILRRRCVERCVLAPYFPPSDPIKFIIAHRVFGASNIIKFLQDLPESQRADAVSSMVYEANARLRDPVYGCAGAICNLQKQ 139
                              7************************************************************************************* PP

                   DUF260  87 leqlkaelallkee 100
                              + +l+++la++++e
  mrna23226.1-v1.0-hybrid 140 VTELQSQLAKAQAE 153
                              **********9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.96453154IPR004883Lateral organ boundaries, LOB
PfamPF031959.9E-4254151IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 225 aa     Download sequence    Send to blast
MECNGNTAAT ATTTTPHSSF TCSPLTSSSS SSPLISSSSP ATSPMPPPAV VVSPCAACKI  60
LRRRCVERCV LAPYFPPSDP IKFIIAHRVF GASNIIKFLQ DLPESQRADA VSSMVYEANA  120
RLRDPVYGCA GAICNLQKQV TELQSQLAKA QAEIINLQCQ QGNLIALICM DMSSTTATNT  180
QQSKEAVVVP ILQQQPYSNL NIDTSCFLDE NNLGTAWDWE PLWT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004307415.11e-165PREDICTED: LOB domain-containing protein 1-like
SwissprotQ9LQR03e-71LBD1_ARATH; LOB domain-containing protein 1
TrEMBLB9HLY22e-93B9HLY2_POPTR; Uncharacterized protein
STRINGPOPTR_0008s04350.15e-93(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF130334106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.14e-64LOB domain-containing protein 1